Loading...
Statistics
Dish.cn.com
Dish.cn.com is hosted in
Hong Kong
/
Central District
.
Dish.cn.com doesn't use HTTPS protocol.
Number of used technologies:
4.
First technologies:
CSS, Html, Html5,
Number of used javascripts: 0.
First javascripts:
Number of used analytics tools:
0.
Its server type is:
nginx/1.10.0.
Technologies in use by Dish.cn.com
Technology
Number of occurences: 4
- CSS
- Html
- Html5
- Php
Advertisement
Javascripts
Number of occurences: 0
Server Type
- nginx/1.10.0
Powered by
- PHP/5.4.45
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Not founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Not founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Not founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Dish.cn.com
Missing HTTPS protocol.
Number of occurences: 3
- Name:
Content: - Name: description
Content: - Name: keywords
Content:
Server / Hosting
- IP: 113.10.173.13
- Latitude: 22.29
- Longitude: 114.15
- Country: Hong Kong
- City: Central District
HTTP Header Response
HTTP/1.1 200 OK
Server: nginx/1.10.0
Date: Sun, 19 Jun 2016 02:32:16 GMT
Content-Type: text/html
X-Powered-By: PHP/5.4.45
X-Cache: MISS from s_xt50
X-Cache-Lookup: MISS from s_xt50:80
Via: 1.1 s_xt50 (squid/3.5.14)
Connection: keep-alive
DNS
host: dish.cn.com
- class: IN
- ttl: 86397
- type: A
- ip: 113.10.173.13
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.ish.cn.com, www.dtish.cn.com, www.tish.cn.com, www.dgish.cn.com, www.gish.cn.com, www.dbish.cn.com, www.bish.cn.com, www.dxish.cn.com, www.xish.cn.com, www.dsish.cn.com, www.sish.cn.com, www.dfish.cn.com, www.fish.cn.com, www.dvish.cn.com, www.vish.cn.com, www.dyish.cn.com, www.yish.cn.com, www.dzish.cn.com, www.zish.cn.com, www.daish.cn.com, www.aish.cn.com, www.deish.cn.com, www.eish.cn.com, www.drish.cn.com, www.rish.cn.com, www.dsh.cn.com, www.dirsh.cn.com, www.drsh.cn.com, www.difsh.cn.com, www.dfsh.cn.com, www.divsh.cn.com, www.dvsh.cn.com, www.diksh.cn.com, www.dksh.cn.com, www.di,sh.cn.com, www.d,sh.cn.com, www.dibsh.cn.com, www.dbsh.cn.com, www.digsh.cn.com, www.dgsh.cn.com, www.ditsh.cn.com, www.dtsh.cn.com, www.diysh.cn.com, www.dysh.cn.com, www.diush.cn.com, www.dush.cn.com, www.dijsh.cn.com, www.djsh.cn.com, www.dimsh.cn.com, www.dmsh.cn.com, www.dinsh.cn.com, www.dnsh.cn.com, www.dih.cn.com, www.diseh.cn.com, www.dieh.cn.com, www.diswh.cn.com, www.diwh.cn.com, www.disdh.cn.com, www.didh.cn.com, www.disxh.cn.com, www.dixh.cn.com, www.disfh.cn.com, www.difh.cn.com, www.disgh.cn.com, www.digh.cn.com, www.disth.cn.com, www.dith.cn.com, www.dis.cn.com, www.dishe.cn.com, www.dise.cn.com, www.dishd.cn.com, www.disd.cn.com, www.dishc.cn.com, www.disc.cn.com, www.dishu.cn.com, www.disu.cn.com, www.dishj.cn.com, www.disj.cn.com, www.dish.cn.com, www.dis.cn.com, www.dishb.cn.com, www.disb.cn.com, www.dishg.cn.com, www.disg.cn.com,
Other websites we recently analyzed
- Home — Lca
La Associazione Rete Italiana LCA si pone come punto di riferimento in Italia per i principali operatori in materia di Life Cycle Assessment (LCA), favorendo sia la diffusione della metodologia a livello nazionale, sia lo scambio di esperienze applicative tese a sostenere l’approccio del ciclo di vita. Mira a consolidare e armonizzare gli strumenti di valutazione per lo sviluppo sostenibile e ad organizzare e realizzare attività a livello nazionale e internazionale di formazione, informazione, documentazione e divulgazione scientifica. L’Associazione, inoltre, si pone l’obiettivo di esercitare azioni d’indirizzo presso gli organi istituzionali, tese a sostenere l’approccio del ciclo di vita e la LCA.Italy - 192.107.92.74
Server software: squid/3.5.12
Technology: CloudFlare, CSS, Html, Html5, Javascript
Number of Javascript: 5
Number of meta tags: 4 - seekandyeeshallfind.com
Scottsdale (United States) - 184.168.221.55
Server software: Microsoft-IIS/7.5
Technology: Html, Html5, Iframe - wesell-lv.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
Cyprus - 93.89.226.17
Server software: Microsoft-IIS/7.5
Technology: CSS, Html - Campement Kunja - Paradijsje in Zuid-Senegal
Netherlands - 188.93.150.48
Server software: Apache/2.4.10
Technology: Html - edirneevdenevenakliyatfirmalari.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
Cyprus - 93.89.226.17
Server software: Microsoft-IIS/7.5
Technology: CSS, Html - uda.wang
Chai Wan (Hong Kong) - 103.51.144.89
Server software: Tengine/1.4.2
Technology: Google Adsense, Html, Javascript, Php
Number of Javascript: 2
Number of meta tags: 1 - Дмитрий Чубаров
San Francisco (United States) - 208.93.0.150
Server software: squid/3.5.14
Technology: AdFox, DoubleClick.Net, CSS, Html, Html5, Iframe, Javascript, Php, SVG, Yandex.Metrika, comScore, Google Analytics, Google Tagmanager
Number of Javascript: 5
Number of meta tags: 2 - KillerLabs
Brea (United States) - 69.163.186.251
Server software: Apache
Technology: CSS, Html - holywoodhillscountryhouse.com
United Kingdom - 81.21.76.62
Server software: Apache/2.2.3 (CentOS)
Technology: CSS, Html, Javascript, Php
Number of Javascript: 1
Number of meta tags: 1 - Serwis Elektryczny Wrocław 24h - tel. 71 307-43-48
Profesjonalne usługi elektryczne we Wrocławiu i okolicach. Obsługujemy klientów indywidualnych, firmy i instytucje. Zapraszam!Poland - 185.49.15.237
Server software: Apache/2
Technology: CSS, Fancybox, Google Font API, Html, Javascript
Number of Javascript: 2
Number of meta tags: 5